PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013621603.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 295aa    MW: 33275.6 Da    PI: 8.2513
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013621603.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.9e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
   XP_013621603.1 14 RGQWTPEEDNKLASYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding40.65.8e-1368110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++  E+ ++v+ +  lG++ W++Ia+ +  gRt++++k++w++
   XP_013621603.1  68 GQFSDAEEHIIVKFHSVLGNR-WSLIAAQLL-GRTDNDVKNYWNT 110
                      7899*****************.********9.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.472965IPR017930Myb domain
SuperFamilySSF466896.74E-2811108IPR009057Homeodomain-like
SMARTSM007173.2E-141363IPR001005SANT/Myb domain
PfamPF002494.6E-181461IPR001005SANT/Myb domain
CDDcd001671.57E-111761No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2265116IPR009057Homeodomain-like
SMARTSM007171.1E-1066114IPR001005SANT/Myb domain
PROSITE profilePS5129417.83566116IPR017930Myb domain
PfamPF002492.9E-1168110IPR001005SANT/Myb domain
CDDcd001673.89E-770112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRIPCCEKE NVKRGQWTPE EDNKLASYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SDAEEHIIVK FHSVLGNRWS LIAAQLLGRT DNDVKNYWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEITTTL NPPQVSHLAE AALGCFKDEM LHLLTKKPGK MKLDNDGNGI  180
MKLWDMGNGF SYGSSSSSFG NDERNEGSAS PAVAAWRGHG GIRTSVAETA AAEEEERRKL  240
KGEVMEQEEI GSEGGRGDGM MMMRRRQHDQ HQQHAFNVDN DLWNLQADDL INHMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4937930.0AB493793.1 Arabidopsis thaliana At5g56110 mRNA for hypothetical protein, partial cds, clone: RAAt5g56110.
GenBankAY5196390.0AY519639.1 Arabidopsis thaliana MYB transcription factor (At5g56110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013621603.10.0PREDICTED: myb-related protein Zm38-like isoform X2
SwissprotQ9XHV01e-174MYB80_ARATH; Transcription factor MYB80
TrEMBLM4F3F40.0M4F3F4_BRARP; Uncharacterized protein
STRINGBra035604.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-160myb domain protein 103